Recombinant Rat Urokinase plasminogen activator surface receptor (Plaur)

Code CSB-YP018122RA
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Alternative Names
PlaurUrokinase plasminogen activator surface receptor; U-PAR; uPAR; CD antigen CD87
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
25-299aa
Target Protein Sequence
LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDAEELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETVCATNLCNRPRPGARGRPFPRGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEPYTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCNGGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSLIDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWCQGSHVADSFQTHVNLSISCCNGSGCNRPTG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
32.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.
Gene References into Functions
  1. Increased postmortem PLAUR expression could serve as a biomarker to aid diagnosis of early myocardial infarction. PMID: 24935436
  2. Rapamycin could promote podocyte migration through the up-regulation of uPAR leading to proteinuria. PMID: 24815166
  3. uPA, uPAR, MMP-2 and MMP-9 play an important role in GBM growth. Blockade of uPA and interruption of the proteolytic cascade could become a useful tool in the therapy of GBM PMID: 22773570
  4. uPAR associates with activating enhancer-binding protein 2alpha (AP2a) and mediates beta-catenin gene transcription. PMID: 22511755
  5. study examines the expression and function of uPAR in developing rat ventral prostates PMID: 11798065
  6. Expression pattern of the urokinase-plasminogen activator system in rat DS-sarcoma: role of oxygenation status and tumour size PMID: 11953898
  7. Decreased expression of intercellular adhesion molecule-1 (ICAM-1) is associated with tumor cell spreading in vivo. PMID: 12198772
  8. demonstrated focused activation of proteolytic enzymatic activity in several cell types and showed that the uPA/uPAR system is an important contributor to focal pericellular proteolysis PMID: 15042374
  9. Altered expression of uPAR in diabetic nephropathy was associated with mesangial expansion. PMID: 15322501
  10. Domain 2 of the urokinase receptor plays a pivotal role in the regulation of uPAR-integrin alphavbeta3 interactions PMID: 15863511
  11. The members of caspases, MEK1/2, PKC, and NF-kappaB are involved in TRAIL-induced expression of uPA, IL-8, MMP-7 and MMP-9. PMID: 18397859
  12. In animals undergoing SE, uPAR expression increased dramatically, peaking at 1 and 4 days after SE. Increased uPAR expression during post-injury phase supports its contribution to tissue remodeling in the brain. PMID: 19527776

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Lipid-anchor, GPI-anchor.; [Isoform 2]: Secreted.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*